DOR19g

LOCUS       DOR19g        1293 bp    DNA             INV       
DEFINITION  Drosophila melanogaster odorant receptor DOR19g,
            GENSCAN predicted complete cds.
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta;
            Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
            Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 1293)
  AUTHORS   Leslie B. Vosshall, Hubert Amrein, Pavel S. Morozov, Andrey
            Rzhetsky and Richard Axel.
  TITLE     A Spatial Map of Olfactory Receptor Expression in the Drosophila
            Antenna
  JOURNAL   Cell (1999) 96:725-736. 
REFERENCE   2  (bases 1 to 1293)
  AUTHORS   Celniker,S.E., Agbayani,A., Arcaina,T.T., Baxter,E., Blazej,R.G.,
            Butenhoff,C., Champe,M., Chavez,C., Chew,M., Ciesiolka,L.,
            Doyle,C.M., Farfan,D.E., Galle,R., George,R.A., Harris,N.L.,
            Hoskins,R.A., Houston,K.A., Hummasti,S.R., Karra,K., Kearney,L.,
            Kim,E., Lee,B., Lewis,S., Li,P., Lomotan,M.A., Mazda,P.,
            Moshrefi,A.R., Moshrefi,M., Nixon,K., Pacleb,J.M., Park,S.,
            Pfeiffer,B., Poon,L., Punch,E., Sequeira,A., Sethi,H., Snir,E.,
            Svirskas,R.R., Twomey,B., Wan,K.H., Weinburg,T., Zhang,R.,
            Zieran,L.L. and Rubin,G.M.
  TITLE     Sequencing of Drosophila melanogaster
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1293)
  AUTHORS   Vosshall,L.B., Amrein,H., Morozov,P.S., Rzhetsky,A. and Axel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MARCH-1999) Department of Biochemistry and Molecular
            Biophysics, HHMI-Columbia University, 701 West 168th Street, New
            York, NY 10032, USA
FEATURES             Location/Qualifiers
Comment:        /note='putative seven transmembrane G protein coupled receptor'
/note='sequence annotation for BDGP P1 clone DS01913; predicted using GENSCAN;
join (72218-70926)'
     source          1..1293
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
                     /chromosome="II"
                     /map="46F5-6"
     mRNA            1..1293
                     /gene="DOR19g"
     gene            1..1293
                     /note="odorant receptor"
                     /gene="DOR19g"
     exon            1..1293
                     /gene="DOR19g"
     CDS             1..1293
                     /gene="DOR19g"
                     /note="odorant receptor"
                     /codon_start=1
                     /product="DOR19g"
                     /translation="MVTEDFYKYQVWYFQILGVWQLPTWAADHQRRFQSMRFGFILVI
LFIMLLLFSFEMLNNISQVREILKVFFMFATEISCMAKLLHLKLKSRKLAGLVDAMLS
PEFGVKSEQEMQMLELDRVAVVRMRNSYGIMSLGAASLILIVPCFDNFGELPLAMLEV
CSIEGWICYWSQYLFHSICLLPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPV
IEPQDNEKIAMELRECAAYYNRIVRFKDLVELFIKGPGSVQLMCSVLVLVSNLYDMST
MSIANGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQSSRLCHSIYSSQWTGWNRAN
RRIVLLMMQRFNSPMLLSTFNPTFAFSLEAFGSVGQQKFLYISFITGYALLLSDRQLL
LQLLRTAEARQQLNFETPQHLKIFKPIFKSTQNVMHVH"
BASE COUNT      290 a    322 c    307 g    374 t
ORIGIN      
        1 atggttacgg aggactttta taagtaccag gtgtggtact tccaaatcct tggtgtttgg
       61 cagctcccca cttgggccgc agaccaccag cgtcgttttc agtccatgag gtttggcttc
      121 atcctggtca tcctgttcat catgctgctg cttttctcct tcgaaatgtt gaacaacatt
      181 tcccaagtta gggagatcct aaaggtattc ttcatgttcg ccacggaaat atcctgcatg
      241 gccaaattat tgcatttgaa gttgaagagc cgcaaactcg ctggcttggt tgatgcgatg
      301 ttgtccccag agttcggcgt taaaagtgaa caggaaatgc agatgctgga attggataga
      361 gtggcggttg tccgcatgag gaactcctac ggcatcatgt ccctgggcgc ggcttccctg
      421 atccttatag ttccctgttt cgacaacttt ggcgagctac cactggccat gttggaggta
      481 tgcagcatcg agggatggat ctgctattgg tcgcagtacc ttttccactc gatttgcctg
      541 ctgcccactt gtgtgctgaa tataacctac gactcggtgg cctactcgtt gctctgtttc
      601 ttgaaggttc agctacaaat gctggtcctg cgattagaaa agttgggtcc tgtgatcgaa
      661 ccccaggata atgagaaaat cgcaatggaa ctgcgtgagt gtgccgccta ctacaacagg
      721 attgttcgtt tcaaggacct ggtggagctg ttcataaagg ggccaggatc tgtgcagctc
      781 atgtgttctg ttctggtgct ggtgtccaac ctgtacgaca tgtccaccat gtccattgca
      841 aacggcgatg ccatctttat gctcaagacc tgtatctatc agctggtgat gctctggcag
      901 atcttcatca tttgctacgc ctccaacgag gtaactgtcc agagctctag gttgtgtcac
      961 agcatctaca gctcccaatg gacgggatgg aacagggcaa accgccggat tgtccttctc
     1021 atgatgcagc gctttaattc cccgatgctc ctgagcacct ttaaccccac ctttgctttc
     1081 agcttggagg cctttggttc tgtagggcag cagaaattcc tttatatatc atttattact
     1141 ggttatgctc ttctcctttc agatcgtcaa ctgctcctac agctacttcg cactgctgaa
     1201 gcgcgtcaac agttaaattt cgaaacaccg cagcacctaa agattttcaa gccgattttt
     1261 aaaagcactc aaaacgttat gcacgtacat taa
//



Back to Top

Site Meter