DOR24g

LOCUS       DOR24g        2075 bp    DNA             INV       
DEFINITION  Drosophila melanogaster odorant receptor DOR24g,
            GENSCAN predicted complete cds.
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta;
            Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
            Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 2075)
  AUTHORS   Leslie B. Vosshall, Hubert Amrein, Pavel S. Morozov, Andrey
            Rzhetsky and Richard Axel.
  TITLE     A Spatial Map of Olfactory Receptor Expression in the Drosophila
            Antenna
  JOURNAL   Cell (1999) 96:725-736. 
REFERENCE   2  (bases 1 to 2075)
  AUTHORS   Celniker,S.E., Agbayani,A., Arcaina,T.T., Baxter,E., Blazej,R.G.,
            Butenhoff,C., Champe,M., Chavez,C., Chew,M., Ciesiolka,L.,
            Doyle,C.M., Farfan,D.E., Galle,R., George,R.A., Harris,N.L.,
            Hoskins,R.A., Houston,K.A., Hummasti,S.R., Karra,K., Kearney,L.,
            Kim,E., Lee,B., Lewis,S., Li,P., Lomotan,M.A., Mazda,P.,
            Moshrefi,A.R., Moshrefi,M., Nixon,K., Pacleb,J.M., Park,S.,
            Pfeiffer,B., Poon,L., Punch,E., Sequeira,A., Sethi,H., Snir,E.,
            Svirskas,R.R., Twomey,B., Wan,K.H., Weinburg,T., Zhang,R.,
            Zieran,L.L. and Rubin,G.M.
  TITLE     Sequencing of Drosophila melanogaster
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 2075)
  AUTHORS   Vosshall,L.B., Amrein,H., Morozov,P.S., Rzhetsky,A. and Axel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MARCH-1999) Department of Biochemistry and Molecular
            Biophysics, HHMI-Columbia University, 701 West 168th Street, New
            York, NY 10032, USA
FEATURES             Location/Qualifiers
     Comment:   /tissue_type='adult antenna'
/note='putative seven transmembrane G protein coupled receptor'
/note='sequence annotation for BDGP P1 clone DS00724; predicted using GENSCAN;
join (62623-64697)'
     source          1..2075
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
                     /chromosome="II"
                     /map="47D6-E2"
     mRNA            join(1..185,739..1038,1338..1953,2025..2075)
                     /gene="DOR24g"
     gene            1..2075
                     /note="odorant receptor"
                     /gene="DOR24g"
     CDS             join(1..185,739..1038,1338..1953,2025..2075)
                     /gene="DOR24g"
                     /note="odorant receptor"
                     /codon_start=1
                     /product="DOR24g"
                     /translation="MRPTLQVLISVLCLVSAYAWDHTDCNDHYIEFMDYPDERATAYS
NESSEWDFFEFWRQVFGLFLQVQKSTIALLGFDLFSENREMWKRPYRAMNVFSIAAIF
PFILAAVLHNWKNVLLLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNG
EFFPWNIHIIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVR
FKGGSLKESQATLNKVFALYQTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFSI
TFAQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGAST
SICRSLLISMMRAHRGFRITGYFFEANMEAFSSIVRTAMSYITMLRSFS"
     exon            1..185
                     /gene="DOR24g"
     intron          186..738
                     /gene="DOR24g"
     exon            739..1038
                     /gene="DOR24g"
     intron          1039..1337
                     /gene="DOR24g"
     exon            1338..1953
                     /gene="DOR24g"
     intron          1954..2024
                     /gene="DOR24g"
     exon            2025..2075
                     /gene="DOR24g"
BASE COUNT      548 a    460 c    447 g    620 t
ORIGIN      
        1 atgcgcccaa cactccaggt cctcatcagt gtcctttgtc tggtctctgc ctacgcctgg
       61 gatcataccg actgtaacga tcactatatc gaattcatgg actatcccga tgagagagct
      121 accgcctata gcaatgaatc ctcagaatgg gatttctttg aattttggag gcaagtgttt
      181 ggcctgtagc aattctgaca tcgctgacca cgcctctggt caaagcaatc acttggcgag
      241 acatgtgacc ctcggatgtc agggcgtgaa taaagaacat taaaatttaa ccggagttct
      301 catttactat gcctaaagag gtgtcaaacg gaggtattat ttgggcgtga tatattatac
      361 cctctaaagg agtatcccca ccaggtgaaa ccctataaaa cccttgacgt cgttaatgga
      421 aagtactgaa ccggaaatga aagtgggcac tttctaatgg tagaaatttg tcgggatgaa
      481 atatataagt agatatatat aatattatat cttgattatc cagcatcaat cacaagataa
      541 aaaaaaaata taattcataa ttcataattc atatgtaata ggcatttgta aatgttgtaa
      601 acaaaggaag ggtattaaag agctgtactt tcgcatctgt atttcattta ttcctactca
      661 attgaaaggt ttaaaacccc tgaactgaac acacttgact tagtgtgagg ccgaattaac
      721 ccttgtcgac atggacagtt ttctgcaagt acagaagagc accattgccc ttctgggctt
      781 tgatctcttt agtgaaaatc gagaaatgtg gaaacgcccc tatagagcaa tgaatgtgtt
      841 tagcatagct gccatttttc cctttatcct ggcagctgtg ctccataatt ggaagaatgt
      901 attgctgctg gccgatgcca tggtggccct actaataacc attctgggcc tattcaagtt
      961 tagcatgata ctttacttac gtcgcgattt caagcgactg attgacaaat ttcgtttgct
     1021 catgtcgaat ggtgagttgt aatccatttc ggccagaatg tgtatcattt catttattat
     1081 tttatagagg cggaacaggg cgaggaatac gccgagattc tcaacgcagc aaacaagcag
     1141 gatcaacgaa tgtgcactct gtttaggact tgtttcctcc tcgcctgggc cttgaatagt
     1201 gttctgcccc tcgtgagaat gggtctcagc tattggttag caggtcatgc agagcccgag
     1261 ttgccttttc cctgtctgta tgtacaaatg atatatatga tatatggtga tcaagttatc
     1321 aggctttgtt cctaaagttt tccctggaat atccacatca ttcgcaatta tgttttgagc
     1381 ttcatctgga gcgctttcgc ctcgacaggt gtggttttac ctgctgtcag cttggatacc
     1441 atattctgtt ccttcaccag caacctgtgc gccttcttca aaattgcgca gtacaaggtg
     1501 gttagattta agggcggatc ccttaaagaa tcacaggcca cattgaacaa agtctttgcc
     1561 ctgtaccaga ccagcttgga tatgtgcaac gatctgaatc agtgctacca accgattatc
     1621 tgcgcccagt tcttcatttc atctctgcaa ctctgcatgc tgggatatct gttctccatt
     1681 acttttgccc agacagaggg cgtctactat gcctcattca tagccacaat cattatacaa
     1741 gcctatatct actgctactg cggggagaac ctgaagacgg agagtgccag cttcgagtgg
     1801 gccatctacg acagtccgtg gcacgagagt ttgggtgctg gtggagcctc tacctcgatc
     1861 tgccgatcct tgctgatcag catgatgcgg gctcatcggg gattccgcat tacgggatac
     1921 tttttcgagg caaacatgga ggccttctca tcggtgggtg aatcatttcc attgtacaat
     1981 acatggattt acatgaatac tcttttctaa ctttccgttt ttagattgtt cgcacggcga
     2041 tgtcctacat cacaatgctg agatcattct cctaa
//



Back to Top

Site Meter