DOR46g

LOCUS       DOR46        1198 bp    DNA             INV       
DEFINITION  Drosophila melanogaster odorant receptor DOR46g,
            GENSCAN predicted complete cds.
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta;
            Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
            Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 1198)
  AUTHORS   Leslie B. Vosshall, Hubert Amrein, Pavel S. Morozov, Andrey
            Rzhetsky and Richard Axel.
  TITLE     A Spatial Map of Olfactory Receptor Expression in the Drosophila
            Antenna
  JOURNAL   Cell (1999) 96:725-736. 
REFERENCE   2  (bases 1 to 1198)
  AUTHORS   Celniker,S.E., Agbayani,A., Arcaina,T.T., Baxter,E., Blazej,R.G.,
            Butenhoff,C., Champe,M., Chavez,C., Chew,M., Ciesiolka,L.,
            Doyle,C.M., Farfan,D.E., Galle,R., George,R.A., Harris,N.L.,
            Hoskins,R.A., Houston,K.A., Hummasti,S.R., Karra,K., Kearney,L.,
            Kim,E., Lee,B., Lewis,S., Li,P., Lomotan,M.A., Mazda,P.,
            Moshrefi,A.R., Moshrefi,M., Nixon,K., Pacleb,J.M., Park,S.,
            Pfeiffer,B., Poon,L., Punch,E., Sequeira,A., Sethi,H., Snir,E.,
            Svirskas,R.R., Twomey,B., Wan,K.H., Weinburg,T., Zhang,R.,
            Zieran,L.L. and Rubin,G.M.
  TITLE     Sequencing of Drosophila melanogaster
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1198)
  AUTHORS   Vosshall,L.B., Amrein,H., Morozov,P.S., Rzhetsky,A. and Axel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MARCH-1999) Department of Biochemistry and Molecular
            Biophysics, HHMI-Columbia University, 701 West 168th Street, New
            York, NY 10032, USA
FEATURES             Location/Qualifiers
Comment:        /note='putative seven transmembrane G protein coupled receptor'
/note='sequence annotation for BDGP P1 clone DS07462; predicted using GENSCAN;
join (1894-697)'
     source          1..1198
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
                     /chromosome="II"
                     /map="59D5-7"
     mRNA            join(1..725,784..1198)
                     /gene="DOR46g"
     gene            1..1198
                     /note="odorant receptor"
                     /gene="DOR46g"
     exon            1..725
                     /gene="DOR46g"
     CDS             join(1..725,784..1198)
                     /gene="DOR46g"
                     /note="odorant receptor"
                     /codon_start=1
                     /product="DOR46g"
                     /translation="MAEVRVDSLEFFKSHWTAWRYLGVAHFRVENWKNLYVFYSIVSN
LLVTLCYPVHLGISLFRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERLL
RLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAW
FPFDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEV
GLDPARDAEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFF
VSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKM
MLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRMRK"
     intron          726..783
                     /gene="DOR46g"
     exon            784..1198
                     /gene="DOR46g"
BASE COUNT      251 a    325 c    310 g    312 t
ORIGIN      
        1 atggcagagg tcagagtgga cagtctggag tttttcaaga gccattggac cgcctggcgg
       61 tacttgggag tggctcattt tcgggtcgag aactggaaga acctttacgt gttttacagc
      121 attgtgtcga atcttctcgt gaccctgtgc taccccgttc acctgggaat atccctcttt
      181 cgcaaccgca ccatcaccga ggacatcctc aacctgacca cctttgcgac ctgcacagcc
      241 tgttcggtga agtgcctgct ctacgcctac aacatcaagg atgtgctgga gatggagcgg
      301 ctgttgaggc ttttggatga acgcgtcgtg ggtccggagc aacgcagcat ctacggacaa
      361 gtgagggtcc agctgcgaaa tgtgctatac gtgttcatcg gcatctacat gccgtgtgcc
      421 ctgttcgccg agctatcctt tctgttcaag gaggagcgcg gtctgatgta tcccgcctgg
      481 tttcccttcg actggctgca ctccaccagg aactattaca tagcgaacgc ctatcagata
      541 gtgggcatct cgtttcagct gctgcaaaac tatgttagcg actgctttcc ggcggtggtg
      601 ctgtgcctga tctcatccca catcaaaatg ttgtacaaca gattcgagga ggtgggcctg
      661 gatccagcca gagatgcgga gaaggacctg gaggcctgca tcaccgatca caagcatatt
      721 ctagagtggg caggcggctc attgtaacgt tcgtgttcta ttcactttcc aacttttttc
      781 cagactattc cgacgcatcg aggccttcat ttccctgccc atgctaattc agttcacagt
      841 gaccgccttg aatgtgtgca tcggtttagc agccctggtg tttttcgtca gcgagcccat
      901 ggcacggatg tacttcatct tctactccct ggccatgccg ctgcagatct ttccgtcctg
      961 ctttttcggc accgacaacg agtactggtt cggacgcctc cactacgcgg ccttcagttg
     1021 caattggcac acacagaaca ggagctttaa gcggaaaatg atgctgttcg ttgagcaatc
     1081 gttgaagaag agcaccgctg tggctggcgg aatgatgcgt atccacctgg acacgttctt
     1141 ttccacccta aagggggcct actccctctt taccatcatt attcggatga gaaagtag
//



Back to Top

Site Meter