DOR62g

LOCUS       DOR62g        1182bp    DNA             INV       
DEFINITION  Drosophila melanogaster odorant receptor DOR62, complete sequence.
predicted from Genefinder analysis
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryotae; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta;
            Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
            Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 38892)
  AUTHORS   Murphy,L., Harris,D. and Barrell,B.
  TITLE     Sequencing the distal X chromosome of Drosophila melanogaster
  JOURNAL   Unpublished
  REMARK    Sanger Centre, Wellcome Trust Genome Campus, Hinxton Hall, Hinxton,
            Cambridge CB10 1SA, U.K.
REFERENCE   2  (bases 1 to 1182)
FEATURES             Location/Qualifiers
     source          1..38892
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
                     /clone="62D9"
     CDS             32969..34150
                     /note="predicted using Genefinder; preliminary prediction"
                     /codon_start=1
                     /product="62D9.q"
                     /db_xref="PID:e1198310"
                     /db_xref="PID:g2655904"
                     /translation="MEKQEDFKLNTHSAVYYHWRVWELTGLMRPPGVSSLLYVVYSIT
                     VNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLKFANVYMVRKQLHEIRS
                     LLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDREL
                     LYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALEL
                     RVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQF
                     VCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALC
                     DAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQARHNYIFKCPL
                     I"


ATGGAGAAGCAAGAGGATTTCAAACTGAACACCCACAGTGCTGTGTACTACCACTGGCGCGTTTGGGAGCTCA
CTGGCCTGATGCGTCCTCCGGGCGTTTCAAGCCTGCTTTACGTGGTATACTCCATTACGGTCAACTTGGTGGT
CACCGTGCTGTTTCCCTTGAGCTTGCTGGCCAGGCTGCTGTTCACCACCAACATGGCCGGATTGTGCGAGAAC
CTGACCATAACTATTACCGATATTGTGGCCAATTTGAAGTTTGCGAATGTGTACATGGTGAGGAAGCAGCTCC
ATGAGATTCGCTCTCTCCTAAGGCTCATGGACGCTAGAGCCCGGCTGGTGGGCGATCCCGAGGAGATTTCTGC
CTTGAGGAAGGAAGTGAATATCGCACAGGGCACTTTCCGCACCTTTGCCAGTATTTTCGTATTTGGCACTACT
TTGAGTTGCGTCCGCGTGGTCGTTCGCCCGGATCGAGAGCTCCTGTATCCGGCCTGGTTCGGCGTTGACTGGA
TGCACTCCACCAGAAACTATGTGCTCATCAATATCTACCAGCTCTTCGGCTTGATAGTGCAGGCTATACAGAA
CTGCGCTAGTGACTCCTATCCGCCTGCGTTTCTCTGCCTGCTCACGGGTCATATGCGTGCTTTGGAGCTGAGG
GTGCGGCGGATTGGCTGCAGGACGGAAAAGTCCAATAAAGGGCAGACATATGAAGCCTGGCGGGAGGAGGTGT
ACCAGGAACTCATCGAGTGCATCCGCGATCTGGCGCGGGTCCATCGGCTGAGGGAGATCATTCAGCGGGTCCT
TTCAGTGCCCTGCATGGCCCAGTTCGTCTGCTCCGCCGCCGTCCAGTGTACCGTCGCCATGCACTTCCTGTAC
GTAGCGGATGACCACGACCACACCGCCATGATCATCTCGATTGTATTTTTCTCGGCCGTCACCTTGGAGGTGT
TTGTAATCTGCTATTTTGGGGACAGGATGCGGACACAGAGCGAGGCGCTGTGCGATGCCTTCTACGATTGCAA
CTGGATAGAACAGCTGCCCAAGTTCAAGCGCGAACTGCTCTTCACCCTGGCCAGGACGCAGCGGCCTTCTCTT
ATCTACGCAGGCAACTACATCGCACTCTCGCTGGAGACCTTCGAGCAGGCAAGGCACAATTATATATTCAAAT
GTCCTTTGATTTGA

//

Back to Top

Site Meter