DOR71g

LOCUS       DOR71g       1252 bp    DNA             INV       
DEFINITION  Drosophila melanogaster odorant receptor DOR71g,
            GENSCAN predicted complete cds.
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta;
            Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
            Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 1252)
  AUTHORS   Leslie B. Vosshall, Hubert Amrein, Pavel S. Morozov, Andrey
            Rzhetsky and Richard Axel.
  TITLE     A Spatial Map of Olfactory Receptor Expression in the Drosophila
            Antenna
  JOURNAL   Cell (1999) 96:725-736. 
REFERENCE   2  (bases 1 to 1252)
  AUTHORS   Celniker,S.E., Agbayani,A., Arcaina,T.T., Baxter,E., Blazej,R.G.,
            Butenhoff,C., Champe,M., Chavez,C., Chew,M., Ciesiolka,L.,
            Doyle,C.M., Farfan,D.E., Galle,R., George,R.A., Harris,N.L.,
            Hoskins,R.A., Houston,K.A., Hummasti,S.R., Karra,K., Kearney,L.,
            Kim,E., Lee,B., Lewis,S., Li,P., Lomotan,M.A., Mazda,P.,
            Moshrefi,A.R., Moshrefi,M., Nixon,K., Pacleb,J.M., Park,S.,
            Pfeiffer,B., Poon,L., Punch,E., Sequeira,A., Sethi,H., Snir,E.,
            Svirskas,R.R., Twomey,B., Wan,K.H., Weinburg,T., Zhang,R.,
            Zieran,L.L. and Rubin,G.M.
  TITLE     Sequencing of Drosophila melanogaster
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1252)
  AUTHORS   Vosshall,L.B., Amrein,H., Morozov,P.S., Rzhetsky,A. and Axel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-March-1999) Department of Biochemistry and Molecular
            Biophysics, HHMI-Columbia University, 701 West 168th Street, New
            York, NY 10032, USA
FEATURES             Location/Qualifiers
     Comment:   /tissue_type='adult maxillary palp'
/note='putative seven transmembrane G protein coupled receptor'
/note='sequence annotation for BDGP P1 clone DS07071; predicted using GENSCAN;
join (26150-24917)'
     source          1..1252
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
                     /chromosome="II"
                     /map="33B1-2"
     exon            1..731
                     /gene="DOR71g"
                     /note="exon"
     mRNA            join(1..731,811..1234)
                     /gene="DOR71g"
     CDS             join(1..731,811..1234)
                     /gene="DOR71g"
                     /note="odorant receptor"
                     /codon_start=1
                     /product="DOR71g"
                     /translation="MVIIDSLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVT
LWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLD
TFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGNWELLYPAY
FPFDLESNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQL
GYFDDETVVNHQRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYML
FFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRF
DLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVVVRAKGI"
     gene            1..1234
                     /note="odorant receptor"
                     /gene="DOR71g"
     intron          732..810
                     /gene="DOR71g"
                     /note="intron"
     exon            811..1231
                     /gene="DOR71g"
                     /note="exon"
     polyA_signal    1246..1252
                     /note="polyA_signal"
BASE COUNT      269 a    299 c    305 g    379 t
ORIGIN      
        1 atggtcatta tcgacagtct tagtttttat cgtccattct ggatctgcat gcgattgctg
       61 gtaccgactt tcttcaagga ttcctcacgt cctgtccagc tgtacgtggt gttgctgcac
      121 atcctggtca ccttgtggtt tccactgcat ctgctgctgc atcttctgct acttccatct
      181 accgctgagt tctttaagaa cctgaccatg tctctgactt gtgtggcctg cagtctgaag
      241 catgtggccc acttgtatca cttgccgcag attgtggaaa tcgaatcact gatcgagcaa
      301 ttagacacat ttattgccag cgaacaggag catcgttact atcgggatca cgtacattgc
      361 catgctaggc gctttacaag atgtctctat attagctttg gcatgatcta tgcgcttttc
      421 ctgttcggcg tcttcgttca ggttattagc ggaaattggg aacttctcta tccagcctat
      481 ttcccattcg acttggagag caatcgcttt ctcggcgcag tagccttggg ctatcaggta
      541 ttcagcatgt tagttgaagg cttccagggg ctgggcaacg atacctatac cccactgacc
      601 ctatgccttc tggccggaca tgtccatttg tggtccatac gaatgggtca actgggatac
      661 ttcgatgacg agacggtggt gaatcatcag cgtttgctgg attacattga gcagcataaa
      721 ctcttggtgc ggtaagcttt gattaactaa cttttgacaa gaagtttatt cactttaact
      781 ggttccaaaa acgatgcact caatgtgcag attccacaac ctggtgagcc ggaccatcag
      841 cgaagtgcaa ctggtgcagc tgggcggatg tggagccact ctgtgcatca ttgtctccta
      901 catgctcttc tttgtgggcg acacaatctc gctggtctac tacttggtgt tctttggagt
      961 ggtctgcgtg cagctctttc ccagctgcta ttttgccagc gaagtagccg aggagttgga
     1021 acggctgcca tatgcgatct tctccagcag atggtacgat caatcgcggg atcatcgatt
     1081 cgatttgctc atctttacac aattaacact gggaaaccgg gggtggatca tcaaggcagg
     1141 aggtcttatc gagctgaatt tgaatgcctt tttcgccacc ctgaagatgg cctattccct
     1201 ttttgcagtt gtggtgcggg caaagggtat atagagagtc tgtttaatta aa
//



Back to Top

Site Meter