DOR73g

LOCUS       DOR73g        1212 bp    DNA             INV       
DEFINITION  Drosophila melanogaster odorant receptor DOR73g,
            GENSCAN predicted complete cds.
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta;
            Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
            Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 1212)
  AUTHORS   Leslie B. Vosshall, Hubert Amrein, Pavel S. Morozov, Andrey
            Rzhetsky and Richard Axel.
  TITLE     A Spatial Map of Olfactory Receptor Expression in the Drosophila
            Antenna
  JOURNAL   Cell (1999) 96:725-736. 
REFERENCE   2  (bases 1 to 1212)
  AUTHORS   Celniker,S.E., Agbayani,A., Arcaina,T.T., Baxter,E., Blazej,R.G.,
            Butenhoff,C., Champe,M., Chavez,C., Chew,M., Ciesiolka,L.,
            Doyle,C.M., Farfan,D.E., Galle,R., George,R.A., Harris,N.L.,
            Hoskins,R.A., Houston,K.A., Hummasti,S.R., Karra,K., Kearney,L.,
            Kim,E., Lee,B., Lewis,S., Li,P., Lomotan,M.A., Mazda,P.,
            Moshrefi,A.R., Moshrefi,M., Nixon,K., Pacleb,J.M., Park,S.,
            Pfeiffer,B., Poon,L., Punch,E., Sequeira,A., Sethi,H., Snir,E.,
            Svirskas,R.R., Twomey,B., Wan,K.H., Weinburg,T., Zhang,R.,
            Zieran,L.L. and Rubin,G.M.
  TITLE     Sequencing of Drosophila melanogaster
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1212)
  AUTHORS   Vosshall,L.B., Amrein,H., Morozov,P.S., Rzhetsky,A. and Axel,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MARCH-1999) Department of Biochemistry and Molecular
            Biophysics, HHMI-Columbia University, 701 West 168th Street, New
            York, NY 10032, USA
FEATURES             Location/Qualifiers
     Comment:   /tissue_type='adult antenna'
/note='putative seven transmembrane G protein coupled receptor'
/note='sequence annotation for BDGP P1 clone DS07071; predicted using GENSCAN;
join (29614-28403)'
     source          1..1212
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
                     /chromosome="II"
                     /map="33B1-2"
     mRNA            join(1..722,798..1212)
                     /gene="DOR73g"
     gene            1..1212
                     /note="odorant receptor"
                     /gene="DOR73g"
     exon            1..722
                     /gene="DOR73g"
                     /note="exon"
     CDS             join(1..722,798..1212)
                     /gene="DOR73g"
                     /note="odorant receptor"
                     /codon_start=1
                     /product="DOR73g"
                     /translation="MDSRRKVRSENLYKTYWLYWRLLGVEGDYPFRRLVDFTITSFIT
ILFPVHLILGMYKKPQIQVFRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDS
RVESEEERNYFNQNPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLGWFPYD
FQATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDV
KLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFA
ENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLI
ILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALSFRV"
     intron          723..797
                     /gene="DOR73g"
                     /note="intron"
     exon            798..1212
                     /gene="DOR73g"
                     /note="exon"
BASE COUNT      352 a    231 c    242 g    387 t
ORIGIN      
        1 atggattcaa gaaggaaagt ccgaagtgaa aatctttaca aaacctattg gctttactgg
       61 cgacttctgg gagtcgaggg cgattatcct tttcgacggc tagtggattt tacaatcacg
      121 tctttcatta cgattttatt tcccgtgcat cttatactgg gaatgtataa aaagccccag
      181 attcaagtct tcaggagtct gcatttcaca tcggaatgcc ttttctgcag ctataagttt
      241 ttctgttttc gttggaaact taaagaaata aagaccatcg aaggattgct ccaggatctc
      301 gatagtcgag ttgaaagtga agaagaacgc aactacttta atcaaaatcc aagtcgtgtg
      361 gctcgaatgc tttcgaaaag ttacttggta gctgctatat cggccataat cactgcaact
      421 gtagctggtt tatttagtac tggtcgaaat ttaatgtatc tgggttggtt tccctacgat
      481 tttcaagcaa ccgccgcaat ctattggatt agtttttcct atcaggcgat tggctctagt
      541 ctgttgattc tggaaaatct ggccaacgat tcatatccgc cgattacatt ttgtgtggtc
      601 tctggacatg tgagactatt gataatgcgt ttaagtcgaa ttggtcacga tgtaaaatta
      661 tcaagttcgg aaaataccag aaaactcatc gaaggtatcc aggatcacag gaaactaatg
      721 aagtaagaat aaagatttaa gaaccgcatg tttgatagct cagagaactg ataattaatc
      781 aaatgtaact tttccaggat aatacgccta cttcgcagca ctttacatct tagccaactg
      841 ggccagttcc tttctagtgg aatcaacatt tccataacac tcatcaacat cctgttcttt
      901 gcggaaaaca actttgcaat gctttattat gcggtgttct ttgctgcaat gttaatagaa
      961 ctatttccaa gttgttacta tggaattctg atgacaatgg agtttgataa gctaccatat
     1021 gccatcttct ccagcaactg gcttaaaatg gataaaagat acaatcgatc cttgataatt
     1081 ctgatgcaac taacactggt tccagtgaat ataaaagcag gtggtattgt tggcatcgat
     1141 atgagtgcat tttttgccac agttcggatg gcatattcct tttacacttt agccttgtca
     1201 tttcgagtat ag
//



Back to Top

Site Meter